Lineage for d2frve_ (2frv E:)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743820Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 743821Superfamily e.19.1: HydA/Nqo6-like [56770] (2 families) (S)
  5. 743822Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (1 protein)
  6. 743823Protein Nickel-iron hydrogenase, small subunit [56772] (5 species)
  7. 743831Species Desulfovibrio gigas [TaxId:879] [56773] (3 PDB entries)
  8. 743836Domain d2frve_: 2frv E: [43305]
    Other proteins in same PDB: d2frvb_, d2frvd_, d2frvf_, d2frvh_, d2frvj_, d2frvl_

Details for d2frve_

PDB Entry: 2frv (more details), 2.54 Å

PDB Description: crystal structure of the oxidized form of ni-fe hydrogenase
PDB Compounds: (E:) periplasmic hydrogenase

SCOP Domain Sequences for d2frve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frve_ e.19.1.1 (E:) Nickel-iron hydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]}
kkrpsvvylhnaectgcsesvlrtvdpyvdelildvismdyhetlmagaghaveealhea
ikgdfvcvieggipmgdggywgkvggrnmydicaevapkakaviaigtcatyggvqaakp
nptgtvgvnealgklgvkainiagcppnpmnfvgtvvhlltkgmpeldkqgrpvmffget
vhdncprlkhfeagefatsfgspeakkgyclyelgckgpdtynncpkqlfnqvnwpvqag
hpciacsepnfwdlyspfysa

SCOP Domain Coordinates for d2frve_:

Click to download the PDB-style file with coordinates for d2frve_.
(The format of our PDB-style files is described here.)

Timeline for d2frve_: