Lineage for d2frvc_ (2frv C:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339721Fold e.19: Nickel-iron hydrogenase, small subunit [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 339722Superfamily e.19.1: Nickel-iron hydrogenase, small subunit [56770] (1 family) (S)
  5. 339723Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (1 protein)
  6. 339724Protein Nickel-iron hydrogenase, small subunit [56772] (5 species)
  7. 339732Species Desulfovibrio gigas [TaxId:879] [56773] (2 PDB entries)
  8. 339734Domain d2frvc_: 2frv C: [43304]
    Other proteins in same PDB: d2frvb_, d2frvd_, d2frvf_, d2frvh_, d2frvj_, d2frvl_

Details for d2frvc_

PDB Entry: 2frv (more details), 2.54 Å

PDB Description: crystal structure of the oxidized form of ni-fe hydrogenase

SCOP Domain Sequences for d2frvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frvc_ e.19.1.1 (C:) Nickel-iron hydrogenase, small subunit {Desulfovibrio gigas}
kkrpsvvylhnaectgcsesvlrtvdpyvdelildvismdyhetlmagaghaveealhea
ikgdfvcvieggipmgdggywgkvggrnmydicaevapkakaviaigtcatyggvqaakp
nptgtvgvnealgklgvkainiagcppnpmnfvgtvvhlltkgmpeldkqgrpvmffget
vhdncprlkhfeagefatsfgspeakkgyclyelgckgpdtynncpkqlfnqvnwpvqag
hpciacsepnfwdlyspfysa

SCOP Domain Coordinates for d2frvc_:

Click to download the PDB-style file with coordinates for d2frvc_.
(The format of our PDB-style files is described here.)

Timeline for d2frvc_: