SCOPe 2.01: Domain d1g2wb_: 1g2w B:

Lineage for d1g2wb_ (1g2w B:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
   2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8

4. Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families)

5. Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)

6. Protein D-aminoacid aminotransferase [56754] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [56756] (1 PDB entry)

8. Domain d1g2wb_: 1g2w B: [43285]
   complexed with act, plp; mutant

Details for d1g2wb_

PDB Entry: 1g2w, 2 Å

PDB Description: e177s mutant of the pyridoxal-5'-phosphate enzyme d-amino acid aminotransferase

PDB Compounds: (B:) d-alanine aminotransferase

SCOPe Domain Sequences for d1g2wb_:

Sequence; same for both SEQRES and ATOM records:

>d1g2wb_ e.17.1.1 (B:) D-aminoacid aminotransferase {Bacillus stearothermophilus [TaxId: 1422]}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtsgss
snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkip

Timeline for d1g2wb_:

• d1g2wb_ first appeared (with stable ids) in SCOP 1.55
  
• d1g2wb_ appears in SCOP 1.75
  
• d1g2wb_ appears in SCOPe 2.02
  
• d1g2wb_ appears in the current release, SCOPe 2.08