Lineage for d1g2wb_ (1g2w B:)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743714Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 743715Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (1 family) (S)
  5. 743716Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (3 proteins)
  6. 743757Protein D-aminoacid aminotransferase [56754] (2 species)
  7. 743773Species Bacillus stearothermophilus [TaxId:1422] [56756] (1 PDB entry)
  8. 743775Domain d1g2wb_: 1g2w B: [43285]
    complexed with act, plp; mutant

Details for d1g2wb_

PDB Entry: 1g2w (more details), 2 Å

PDB Description: e177s mutant of the pyridoxal-5'-phosphate enzyme d-amino acid aminotransferase
PDB Compounds: (B:) d-alanine aminotransferase

SCOP Domain Sequences for d1g2wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2wb_ e.17.1.1 (B:) D-aminoacid aminotransferase {Bacillus stearothermophilus [TaxId: 1422]}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtsgss
snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkip

SCOP Domain Coordinates for d1g2wb_:

Click to download the PDB-style file with coordinates for d1g2wb_.
(The format of our PDB-style files is described here.)

Timeline for d1g2wb_: