Lineage for d1g2wb_ (1g2w B:)
- Root: SCOP 1.55
Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds) 
Fold e.17: D-amino acid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily) Superfamily e.17.1: D-amino acid aminotransferase-like PLP-dependent enzymes [56752] (1 family) 
Family e.17.1.1: D-amino acid aminotransferase-like PLP-dependent enzymes [56753] (3 proteins) Protein D-amino acid aminotransferase [56754] (2 species) 
Species Bacillus stearothermophilus [TaxId:1422] [56756] (1 PDB entry) 
Domain d1g2wb_: 1g2w B: [43285]
Details for d1g2wb_
PDB Entry: 1g2w (more details), 2 Å
PDB Description: e177s mutant of the pyridoxal-5'-phosphate enzyme d-amino acid aminotransferase
SCOP Domain Sequences for d1g2wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g2wb_ e.17.1.1 (B:) D-amino acid aminotransferase {Bacillus stearothermophilus}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtsgss
snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkip
SCOP Domain Coordinates for d1g2wb_:
Click to download the PDB-style file with coordinates for d1g2wb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g2wb_:
- d1g2wb_ appears in SCOP 1.57
- d1g2wb_ appears in the current release, SCOPe 2.08
View in 3D
