Lineage for d1g2wa_ (1g2w A:)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 141386Fold e.17: D-amino acid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
  4. 141387Superfamily e.17.1: D-amino acid aminotransferase-like PLP-dependent enzymes [56752] (1 family) (S)
  5. 141388Family e.17.1.1: D-amino acid aminotransferase-like PLP-dependent enzymes [56753] (3 proteins)
  6. 141413Protein D-amino acid aminotransferase [56754] (2 species)
  7. 141429Species Bacillus stearothermophilus [TaxId:1422] [56756] (1 PDB entry)
  8. 141430Domain d1g2wa_: 1g2w A: [43284]

Details for d1g2wa_

PDB Entry: 1g2w (more details), 2 Å

PDB Description: e177s mutant of the pyridoxal-5'-phosphate enzyme d-amino acid aminotransferase

SCOP Domain Sequences for d1g2wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2wa_ e.17.1.1 (A:) D-amino acid aminotransferase {Bacillus stearothermophilus}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtsgss
snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkip

SCOP Domain Coordinates for d1g2wa_:

Click to download the PDB-style file with coordinates for d1g2wa_.
(The format of our PDB-style files is described here.)

Timeline for d1g2wa_: