Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily) 2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8 |
Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) |
Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins) |
Protein D-aminoacid aminotransferase [56754] (2 species) |
Species Bacillus stearothermophilus [TaxId:1422] [56756] (1 PDB entry) |
Domain d1g2wa_: 1g2w A: [43284] complexed with act, plp; mutant |
PDB Entry: 1g2w (more details), 2 Å
SCOPe Domain Sequences for d1g2wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g2wa_ e.17.1.1 (A:) D-aminoacid aminotransferase {Bacillus stearothermophilus [TaxId: 1422]} gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtsgss snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts ttseitpvieidgklirdgkvgewtrklqkqfetkip
Timeline for d1g2wa_: