Lineage for d1g2wa_ (1g2w A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018494Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 3018495Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 3018496Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)
  6. 3018574Protein D-aminoacid aminotransferase [56754] (2 species)
  7. 3018592Species Bacillus stearothermophilus [TaxId:1422] [56756] (1 PDB entry)
  8. 3018593Domain d1g2wa_: 1g2w A: [43284]
    complexed with act, plp; mutant

Details for d1g2wa_

PDB Entry: 1g2w (more details), 2 Å

PDB Description: e177s mutant of the pyridoxal-5'-phosphate enzyme d-amino acid aminotransferase
PDB Compounds: (A:) d-alanine aminotransferase

SCOPe Domain Sequences for d1g2wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2wa_ e.17.1.1 (A:) D-aminoacid aminotransferase {Bacillus stearothermophilus [TaxId: 1422]}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtsgss
snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkip

SCOPe Domain Coordinates for d1g2wa_:

Click to download the PDB-style file with coordinates for d1g2wa_.
(The format of our PDB-style files is described here.)

Timeline for d1g2wa_: