Lineage for d5daab_ (5daa B:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1056766Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 1056767Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 1056768Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)
  6. 1056813Protein D-aminoacid aminotransferase [56754] (2 species)
  7. 1056814Species Bacillus sp., strain YM-1 [TaxId:1409] [56755] (8 PDB entries)
    domain 1: 1-120; domain 2: 121-277
  8. 1056830Domain d5daab_: 5daa B: [43283]
    complexed with plp; mutant

Details for d5daab_

PDB Entry: 5daa (more details), 2.9 Å

PDB Description: e177k mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate
PDB Compounds: (B:) d-amino acid aminotransferase

SCOPe Domain Sequences for d5daab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5daab_ e.17.1.1 (B:) D-aminoacid aminotransferase {Bacillus sp., strain YM-1 [TaxId: 1409]}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtkgss
snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkip

SCOPe Domain Coordinates for d5daab_:

Click to download the PDB-style file with coordinates for d5daab_.
(The format of our PDB-style files is described here.)

Timeline for d5daab_: