SCOP 1.57: Domain d5daaa_: 5daa A:

Lineage for d5daaa_ (5daa A:)

1. Root: SCOP 1.57

2. Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)

3. Fold e.17: D-amino acid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)

4. Superfamily e.17.1: D-amino acid aminotransferase-like PLP-dependent enzymes [56752] (1 family)

5. Family e.17.1.1: D-amino acid aminotransferase-like PLP-dependent enzymes [56753] (3 proteins)

6. Protein D-amino acid aminotransferase [56754] (2 species)

7. Species Bacillus sp., strain YM-1 [TaxId:1409] [56755] (7 PDB entries)

8. Domain d5daaa_: 5daa A: [43282]

Details for d5daaa_

PDB Entry: 5daa, 2.9 Å

PDB Description: e177k mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate

SCOP Domain Sequences for d5daaa_:

Sequence; same for both SEQRES and ATOM records:

>d5daaa_ e.17.1.1 (A:) D-amino acid aminotransferase {Bacillus sp., strain YM-1}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtkgss
snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkip

Timeline for d5daaa_:

• d5daaa_ first appeared (with stable ids) in SCOP 1.55
  
• d5daaa_ appears in SCOP 1.59
  
• d5daaa_ appears in the current release, SCOPe 2.08