Lineage for d4daab_ (4daa B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624092Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2624093Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2624094Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)
  6. 2624172Protein D-aminoacid aminotransferase [56754] (2 species)
  7. 2624173Species Bacillus sp., strain YM-1 [TaxId:1409] [56755] (8 PDB entries)
    domain 1: 1-120; domain 2: 121-277
  8. 2624187Domain d4daab_: 4daa B: [43281]
    complexed with plp, so4

Details for d4daab_

PDB Entry: 4daa (more details), 2.4 Å

PDB Description: crystallographic structure of d-amino acid aminotransferase in pyridoxal-5'-phosphate (plp) form
PDB Compounds: (B:) d-amino acid aminotransferase

SCOPe Domain Sequences for d4daab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4daab_ e.17.1.1 (B:) D-aminoacid aminotransferase {Bacillus sp., strain YM-1 [TaxId: 1409]}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkip

SCOPe Domain Coordinates for d4daab_:

Click to download the PDB-style file with coordinates for d4daab_.
(The format of our PDB-style files is described here.)

Timeline for d4daab_: