Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily) 2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8 |
Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) |
Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins) |
Protein D-aminoacid aminotransferase [56754] (2 species) |
Species Bacillus sp., strain YM-1 [TaxId:1409] [56755] (8 PDB entries) domain 1: 1-120; domain 2: 121-277 |
Domain d1a0gb_: 1a0g B: [43277] complexed with pmp; mutant |
PDB Entry: 1a0g (more details), 2 Å
SCOPe Domain Sequences for d1a0gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0gb_ e.17.1.1 (B:) D-aminoacid aminotransferase {Bacillus sp., strain YM-1 [TaxId: 1409]} gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss snvfgikdgilythpannmiakgitrdvviacaneinmpvkeipftthealkmdelfvts ttseitpvieidgklirdgkvgewtrklqkqfetkipkplhi
Timeline for d1a0gb_: