Lineage for d1a0gb_ (1a0g B:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38585Fold e.17: D-amino acid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
  4. 38586Superfamily e.17.1: D-amino acid aminotransferase-like PLP-dependent enzymes [56752] (1 family) (S)
  5. 38587Family e.17.1.1: D-amino acid aminotransferase-like PLP-dependent enzymes [56753] (3 proteins)
  6. 38596Protein D-amino acid aminotransferase [56754] (2 species)
  7. 38597Species Bacillus sp., strain YM-1 [TaxId:1409] [56755] (7 PDB entries)
  8. 38603Domain d1a0gb_: 1a0g B: [43277]

Details for d1a0gb_

PDB Entry: 1a0g (more details), 2 Å

PDB Description: l201a mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate

SCOP Domain Sequences for d1a0gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0gb_ e.17.1.1 (B:) D-amino acid aminotransferase {Bacillus sp., strain YM-1}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
snvfgikdgilythpannmiakgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkipkplhi

SCOP Domain Coordinates for d1a0gb_:

Click to download the PDB-style file with coordinates for d1a0gb_.
(The format of our PDB-style files is described here.)

Timeline for d1a0gb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a0ga_