Lineage for d1a0ga_ (1a0g A:)
- Root: SCOP 1.55
Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds) 
Fold e.17: D-amino acid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily) Superfamily e.17.1: D-amino acid aminotransferase-like PLP-dependent enzymes [56752] (1 family) 
Family e.17.1.1: D-amino acid aminotransferase-like PLP-dependent enzymes [56753] (3 proteins) Protein D-amino acid aminotransferase [56754] (2 species) Species Bacillus sp., strain YM-1 [TaxId:1409] [56755] (7 PDB entries) 
Domain d1a0ga_: 1a0g A: [43276]
Details for d1a0ga_
PDB Entry: 1a0g (more details), 2 Å
PDB Description: l201a mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate
SCOP Domain Sequences for d1a0ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0ga_ e.17.1.1 (A:) D-amino acid aminotransferase {Bacillus sp., strain YM-1}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
snvfgikdgilythpannmiakgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkipkpl
SCOP Domain Coordinates for d1a0ga_:
Click to download the PDB-style file with coordinates for d1a0ga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a0ga_:
- d1a0ga_ appears in SCOP 1.57
- d1a0ga_ appears in the current release, SCOPe 2.08
View in 3D
