Lineage for d1a0ga_ (1a0g A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)
  6. Protein D-aminoacid aminotransferase [56754] (2 species)
  7. Species Bacillus sp., strain YM-1 [TaxId:1409] [56755] (8 PDB entries)
    domain 1: 1-120; domain 2: 121-277
  8. Domain d1a0ga_: 1a0g A: [43276]
    complexed with pmp; mutant

Details for d1a0ga_

PDB Entry: 1a0g (more details), 2 Å

PDB Description: l201a mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate
PDB Compounds: (A:) d-amino acid aminotransferase

SCOPe Domain Sequences for d1a0ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0ga_ e.17.1.1 (A:) D-aminoacid aminotransferase {Bacillus sp., strain YM-1 [TaxId: 1409]}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
snvfgikdgilythpannmiakgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkipkpl

SCOPe Domain Coordinates for d1a0ga_ are not available.

Timeline for d1a0ga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a0gb_