Lineage for d2dabb_ (2dab B:)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 141386Fold e.17: D-amino acid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
  4. 141387Superfamily e.17.1: D-amino acid aminotransferase-like PLP-dependent enzymes [56752] (1 family) (S)
  5. 141388Family e.17.1.1: D-amino acid aminotransferase-like PLP-dependent enzymes [56753] (3 proteins)
  6. 141413Protein D-amino acid aminotransferase [56754] (2 species)
  7. 141414Species Bacillus sp., strain YM-1 [TaxId:1409] [56755] (7 PDB entries)
  8. 141422Domain d2dabb_: 2dab B: [43275]

Details for d2dabb_

PDB Entry: 2dab (more details), 2 Å

PDB Description: l201a mutant of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate

SCOP Domain Sequences for d2dabb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dabb_ e.17.1.1 (B:) D-amino acid aminotransferase {Bacillus sp., strain YM-1}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
snvfgikdgilythpannmiakgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkipkplhi

SCOP Domain Coordinates for d2dabb_:

Click to download the PDB-style file with coordinates for d2dabb_.
(The format of our PDB-style files is described here.)

Timeline for d2dabb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2daba_