SCOPe 2.01: Domain d2daba_: 2dab A:

Lineage for d2daba_ (2dab A:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
   2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8

4. Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families)

5. Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)

6. Protein D-aminoacid aminotransferase [56754] (2 species)

7. Species Bacillus sp., strain YM-1 [TaxId:1409] [56755] (8 PDB entries)
   domain 1: 1-120; domain 2: 121-277

8. Domain d2daba_: 2dab A: [43274]
   complexed with plp; mutant

Details for d2daba_

PDB Entry: 2dab, 2 Å

PDB Description: l201a mutant of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate

PDB Compounds: (A:) d-amino acid aminotransferase

SCOPe Domain Sequences for d2daba_:

Sequence; same for both SEQRES and ATOM records:

>d2daba_ e.17.1.1 (A:) D-aminoacid aminotransferase {Bacillus sp., strain YM-1 [TaxId: 1409]}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
snvfgikdgilythpannmiakgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkipkpl

Timeline for d2daba_:

• d2daba_ first appeared (with stable ids) in SCOP 1.55
  
• d2daba_ appears in SCOP 1.75
  
• d2daba_ appears in SCOPe 2.02
  
• d2daba_ appears in the current release, SCOPe 2.08