SCOPe 2.08: Domain d3daab_: 3daa B:

Lineage for d3daab_ (3daa B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
   2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8

4. Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families)

5. Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)

6. Protein D-aminoacid aminotransferase [56754] (2 species)

7. Species Bacillus sp., strain YM-1 [TaxId:1409] [56755] (8 PDB entries)
   domain 1: 1-120; domain 2: 121-277

8. Domain d3daab_: 3daa B: [43273]
   complexed with pdd

Details for d3daab_

PDB Entry: 3daa, 1.9 Å

PDB Description: crystallographic structure of d-amino acid aminotransferase inactivated by pyridoxyl-d-alanine

PDB Compounds: (B:) d-amino acid aminotransferase

SCOPe Domain Sequences for d3daab_:

Sequence; same for both SEQRES and ATOM records:

>d3daab_ e.17.1.1 (B:) D-aminoacid aminotransferase {Bacillus sp., strain YM-1 [TaxId: 1409]}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkip

Timeline for d3daab_:

• d3daab_ first appeared (with stable ids) in SCOP 1.55
  
• d3daab_ appears in SCOPe 2.07