Lineage for d3daaa_ (3daa A:)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 885041Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 885042Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (1 family) (S)
  5. 885043Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (3 proteins)
  6. 885084Protein D-aminoacid aminotransferase [56754] (2 species)
  7. 885085Species Bacillus sp., strain YM-1 [TaxId:1409] [56755] (7 PDB entries)
    domain 1: 1-120; domain 2: 121-277
  8. 885088Domain d3daaa_: 3daa A: [43272]

Details for d3daaa_

PDB Entry: 3daa (more details), 1.9 Å

PDB Description: crystallographic structure of d-amino acid aminotransferase inactivated by pyridoxyl-d-alanine
PDB Compounds: (A:) d-amino acid aminotransferase

SCOP Domain Sequences for d3daaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3daaa_ e.17.1.1 (A:) D-aminoacid aminotransferase {Bacillus sp., strain YM-1 [TaxId: 1409]}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkip

SCOP Domain Coordinates for d3daaa_:

Click to download the PDB-style file with coordinates for d3daaa_.
(The format of our PDB-style files is described here.)

Timeline for d3daaa_: