![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily) 2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8 |
![]() | Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) ![]() |
![]() | Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins) |
![]() | Protein D-aminoacid aminotransferase [56754] (2 species) |
![]() | Species Bacillus sp., strain YM-1 [TaxId:1409] [56755] (8 PDB entries) domain 1: 1-120; domain 2: 121-277 |
![]() | Domain d3daaa_: 3daa A: [43272] complexed with pdd |
PDB Entry: 3daa (more details), 1.9 Å
SCOPe Domain Sequences for d3daaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3daaa_ e.17.1.1 (A:) D-aminoacid aminotransferase {Bacillus sp., strain YM-1 [TaxId: 1409]} gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts ttseitpvieidgklirdgkvgewtrklqkqfetkip
Timeline for d3daaa_: