SCOP 1.75: Domain d1daab_: 1daa B:

Lineage for d1daab_ (1daa B:)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
   2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8

4. Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (1 family)

5. Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (3 proteins)

6. Protein D-aminoacid aminotransferase [56754] (2 species)

7. Species Bacillus sp., strain YM-1 [TaxId:1409] [56755] (7 PDB entries)
   domain 1: 1-120; domain 2: 121-277

8. Domain d1daab_: 1daa B: [43271]
   complexed with plp

Details for d1daab_

PDB Entry: 1daa, 1.94 Å

PDB Description: crystallographic structure of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate

PDB Compounds: (B:) d-amino acid aminotransferase

SCOP Domain Sequences for d1daab_:

Sequence; same for both SEQRES and ATOM records:

>d1daab_ e.17.1.1 (B:) D-aminoacid aminotransferase {Bacillus sp., strain YM-1 [TaxId: 1409]}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkip

Timeline for d1daab_:

• d1daab_ first appeared (with stable ids) in SCOP 1.55
  
• d1daab_ appears in SCOP 1.73
  
• d1daab_ appears in SCOPe 2.01
  
• d1daab_ appears in the current release, SCOPe 2.08