Lineage for d1a36a3 (1a36 A:215-430)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624070Fold e.15: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56740] (1 superfamily)
    2 domains: alpha+beta and all-beta
  4. 2624071Superfamily e.15.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56741] (1 family) (S)
    automatically mapped to Pfam PF02919
  5. 2624072Family e.15.1.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56742] (1 protein)
  6. 2624073Protein Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56743] (2 species)
  7. 2624076Species Human (Homo sapiens) [TaxId:9606] [56744] (15 PDB entries)
    Uniprot P11387 203-765 ! Uniprot P11387 203-767
  8. 2624083Domain d1a36a3: 1a36 A:215-430 [43266]
    Other proteins in same PDB: d1a36a1, d1a36a2
    protein/DNA complex

Details for d1a36a3

PDB Entry: 1a36 (more details), 2.8 Å

PDB Description: topoisomerase i/dna complex
PDB Compounds: (A:) topoisomerase I

SCOPe Domain Sequences for d1a36a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a36a3 e.15.1.1 (A:215-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens) [TaxId: 9606]}
ikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffakmldheyttkeif
rknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmskeeklkikeenekl
lkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpediiincskdakvps
pppghkwkevrhdnkvtwlvswteniqgsikyimln

SCOPe Domain Coordinates for d1a36a3:

Click to download the PDB-style file with coordinates for d1a36a3.
(The format of our PDB-style files is described here.)

Timeline for d1a36a3: