Lineage for d1ej9a2 (1ej9 A:203-430)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424911Fold e.15: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56740] (1 superfamily)
    2 domains: alpha+beta and all-beta
  4. 424912Superfamily e.15.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56741] (1 family) (S)
  5. 424913Family e.15.1.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56742] (1 protein)
  6. 424914Protein Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56743] (2 species)
  7. 424917Species Human (Homo sapiens) [TaxId:9606] [56744] (9 PDB entries)
  8. 424921Domain d1ej9a2: 1ej9 A:203-430 [43265]
    Other proteins in same PDB: d1ej9a1
    protein/DNA complex; mutant

Details for d1ej9a2

PDB Entry: 1ej9 (more details), 2.6 Å

PDB Description: crystal structure of human topoisomerase i dna complex

SCOP Domain Sequences for d1ej9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ej9a2 e.15.1.1 (A:203-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens)}
wkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffak
mldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmske
eklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpedi
iincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimln

SCOP Domain Coordinates for d1ej9a2:

Click to download the PDB-style file with coordinates for d1ej9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ej9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ej9a1