Lineage for d1ej9a2 (1ej9 A:203-430)
- Root: SCOP 1.61
Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds) 
Fold e.15: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56740] (1 superfamily) Superfamily e.15.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56741] (1 family) 
Family e.15.1.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56742] (1 protein) Protein Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56743] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [56744] (5 PDB entries) 
Domain d1ej9a2: 1ej9 A:203-430 [43265]
Other proteins in same PDB: d1ej9a1
Details for d1ej9a2
PDB Entry: 1ej9 (more details), 2.6 Å
PDB Description: crystal structure of human topoisomerase i dna complex
SCOP Domain Sequences for d1ej9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ej9a2 e.15.1.1 (A:203-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens)}
wkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffak
mldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmske
eklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpedi
iincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimln
SCOP Domain Coordinates for d1ej9a2:
Click to download the PDB-style file with coordinates for d1ej9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ej9a2:
- d1ej9a2 first appeared (with stable ids) in SCOP 1.55
- d1ej9a2 appears in SCOP 1.59
- d1ej9a2 appears in SCOP 1.63
- d1ej9a2 appears in the current release, SCOPe 2.08
View in 3D
