Lineage for d1a35a2 (1a35 A:215-430)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743692Fold e.15: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56740] (1 superfamily)
    2 domains: alpha+beta and all-beta
  4. 743693Superfamily e.15.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56741] (1 family) (S)
  5. 743694Family e.15.1.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56742] (1 protein)
  6. 743695Protein Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56743] (2 species)
  7. 743698Species Human (Homo sapiens) [TaxId:9606] [56744] (15 PDB entries)
  8. 743702Domain d1a35a2: 1a35 A:215-430 [43264]
    Other proteins in same PDB: d1a35a1
    protein/DNA complex; complexed with bru; mutant

Details for d1a35a2

PDB Entry: 1a35 (more details), 2.5 Å

PDB Description: human topoisomerase i/dna complex
PDB Compounds: (A:) protein (DNA topoisomerase I)

SCOP Domain Sequences for d1a35a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a35a2 e.15.1.1 (A:215-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens) [TaxId: 9606]}
ikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffakmldheyttkeif
rknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmskeeklkikeenekl
lkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpediiincskdakvps
pppghkwkevrhdnkvtwlvswteniqgsikyimln

SCOP Domain Coordinates for d1a35a2:

Click to download the PDB-style file with coordinates for d1a35a2.
(The format of our PDB-style files is described here.)

Timeline for d1a35a2: