Lineage for d1eqne_ (1eqn E:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624037Fold e.13: DNA primase core [56730] (1 superfamily)
    2 domains: (1) alpha+beta; (2) toprim alpha/beta
  4. 2624038Superfamily e.13.1: DNA primase core [56731] (3 families) (S)
  5. 2624039Family e.13.1.1: DNA primase DnaG catalytic core [56732] (2 proteins)
  6. 2624040Protein DNA primase DnaG catalytic core [56733] (1 species)
  7. 2624041Species Escherichia coli [TaxId:562] [56734] (3 PDB entries)
  8. 2624048Domain d1eqne_: 1eqn E: [43260]

Details for d1eqne_

PDB Entry: 1eqn (more details), 2.9 Å

PDB Description: e.coli primase catalytic core
PDB Compounds: (E:) DNA primase

SCOPe Domain Sequences for d1eqne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqne_ e.13.1.1 (E:) DNA primase DnaG catalytic core {Escherichia coli [TaxId: 562]}
tlyqlmdglntfyqqslqqpvatsarqylekrglsheviarfaigfappgwdnvlkrfgg
npenrqslidagmlvtndqgrsydrfrervmfpirdkrgrvigfggrvlgndtpkylnsp
etdifhkgrqlyglyeaqqdnaepnrllvvegymdvvalaqyginyavaslgtsttadhi
qllfratnnviccydgdragrdaawraletalpymtdgrqlrfmflpdgedpdtlvrkeg
keafearmeqamplsaflfnslmpqvdlstpdgrarlstlalplisqvpgetlriylrqe
lgnklgil

SCOPe Domain Coordinates for d1eqne_:

Click to download the PDB-style file with coordinates for d1eqne_.
(The format of our PDB-style files is described here.)

Timeline for d1eqne_: