Lineage for d1eqnd_ (1eqn D:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018439Fold e.13: DNA primase core [56730] (1 superfamily)
    2 domains: (1) alpha+beta; (2) toprim alpha/beta
  4. 3018440Superfamily e.13.1: DNA primase core [56731] (3 families) (S)
  5. 3018441Family e.13.1.1: DNA primase DnaG catalytic core [56732] (2 proteins)
  6. 3018442Protein DNA primase DnaG catalytic core [56733] (1 species)
  7. 3018443Species Escherichia coli [TaxId:562] [56734] (3 PDB entries)
  8. 3018449Domain d1eqnd_: 1eqn D: [43259]

Details for d1eqnd_

PDB Entry: 1eqn (more details), 2.9 Å

PDB Description: e.coli primase catalytic core
PDB Compounds: (D:) DNA primase

SCOPe Domain Sequences for d1eqnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqnd_ e.13.1.1 (D:) DNA primase DnaG catalytic core {Escherichia coli [TaxId: 562]}
tlyqlmdglntfyqqslqqpvatsarqylekrglsheviarfaigfappgwdnvlkrfgg
npenrqslidagmlvtndqgrsydrfrervmfpirdkrgrvigfggrvlgndtpkylnsp
etdifhkgrqlyglyeaqqdnaepnrllvvegymdvvalaqyginyavaslgtsttadhi
qllfratnnviccydgdragrdaawraletalpymtdgrqlrfmflpdgedpdtlvrkeg
keafearmeqamplsaflfnslmpqvdlstpdgrarlstlalplisqvpgetlriylrqe
lgnklgilddsqle

SCOPe Domain Coordinates for d1eqnd_:

Click to download the PDB-style file with coordinates for d1eqnd_.
(The format of our PDB-style files is described here.)

Timeline for d1eqnd_: