Lineage for d1eqnb_ (1eqn B:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38548Fold e.13: DNA primase DnaG catalytic core [56730] (1 superfamily)
  4. 38549Superfamily e.13.1: DNA primase DnaG catalytic core [56731] (1 family) (S)
  5. 38550Family e.13.1.1: DNA primase DnaG catalytic core [56732] (1 protein)
  6. 38551Protein DNA primase DnaG catalytic core [56733] (1 species)
  7. 38552Species Escherichia coli [TaxId:562] [56734] (3 PDB entries)
  8. 38556Domain d1eqnb_: 1eqn B: [43257]

Details for d1eqnb_

PDB Entry: 1eqn (more details), 2.9 Å

PDB Description: e.coli primase catalytic core

SCOP Domain Sequences for d1eqnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqnb_ e.13.1.1 (B:) DNA primase DnaG catalytic core {Escherichia coli}
tlyqlmdglntfyqqslqqpvatsarqylekrglsheviarfaigfappgwdnvlkrfgg
npenrqslidagmlvtndqgrsydrfrervmfpirdkrgrvigfggrvlgndtpkylnsp
etdifhkgrqlyglyeaqqdnaepnrllvvegymdvvalaqyginyavaslgtsttadhi
qllfratnnviccydgdragrdaawraletalpymtdgrqlrfmflpdgedpdtlvrkeg
keafearmeqamplsaflfnslmpqvdlstpdgrarlstlalplisqvpgetlriylrqe
lgnklgilddsql

SCOP Domain Coordinates for d1eqnb_:

Click to download the PDB-style file with coordinates for d1eqnb_.
(The format of our PDB-style files is described here.)

Timeline for d1eqnb_: