Lineage for d1ddea_ (1dde A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624037Fold e.13: DNA primase core [56730] (1 superfamily)
    2 domains: (1) alpha+beta; (2) toprim alpha/beta
  4. 2624038Superfamily e.13.1: DNA primase core [56731] (3 families) (S)
  5. 2624039Family e.13.1.1: DNA primase DnaG catalytic core [56732] (2 proteins)
  6. 2624040Protein DNA primase DnaG catalytic core [56733] (1 species)
  7. 2624041Species Escherichia coli [TaxId:562] [56734] (3 PDB entries)
  8. 2624043Domain d1ddea_: 1dde A: [43255]
    complexed with y1

Details for d1ddea_

PDB Entry: 1dde (more details), 1.7 Å

PDB Description: structure of the dnag catalytic core
PDB Compounds: (A:) DNA primase

SCOPe Domain Sequences for d1ddea_:

Sequence, based on SEQRES records: (download)

>d1ddea_ e.13.1.1 (A:) DNA primase DnaG catalytic core {Escherichia coli [TaxId: 562]}
tlyqlmdglntfyqqslqqpvatsarqylekrglsheviarfaigfappgwdnvlkrfgg
npenrqslidagmlvtndqgrsydrfrervmfpirdkrgrvigfggrvlgndtpkylnsp
etdifhkgrqlyglyeaqqdnaepnrllvvegymdvvalaqyginyavaslgtsttadhi
qllfratnnviccydgdragrdaawraletalpymtdgrqlrfmflpdgedpdtlvrkeg
keafearmeqamplsaflfnslmpqvdlstpdgrarlstlalplisqvpgetlriylrqe
lgnklgilddsql

Sequence, based on observed residues (ATOM records): (download)

>d1ddea_ e.13.1.1 (A:) DNA primase DnaG catalytic core {Escherichia coli [TaxId: 562]}
tlyqlmdglntfyqqslqqpvatsarqylekrglsheviarfaigfappgwdnvlkrfgg
npenrqslidagmlvtnrsydrfrervmfpirdkrgrvigfggrvlgndtpkylnspetd
ifhkgrqlyglyeaqqdnaepnrllvvegymdvvalaqyginyavaslgtsttadhiqll
fratnnviccydgdragrdaawraletalpymtdgrqlrfmflpdgedpdtlvrkegkea
fearmeqamplsaflfnslmpqvdlstpdgrarlstlalplisqvpgetlriylrqelgn
klgilddsql

SCOPe Domain Coordinates for d1ddea_:

Click to download the PDB-style file with coordinates for d1ddea_.
(The format of our PDB-style files is described here.)

Timeline for d1ddea_: