Lineage for d1d3yb_ (1d3y B:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 87191Fold e.12: DNA topoisomerase IV, alpha subunit [56725] (1 superfamily)
  4. 87192Superfamily e.12.1: DNA topoisomerase IV, alpha subunit [56726] (1 family) (S)
  5. 87193Family e.12.1.1: DNA topoisomerase IV, alpha subunit [56727] (1 protein)
  6. 87194Protein DNA topoisomerase IV, alpha subunit [56728] (1 species)
  7. 87195Species Archaeon Methanococcus jannaschii [TaxId:2190] [56729] (1 PDB entry)
  8. 87197Domain d1d3yb_: 1d3y B: [43253]

Details for d1d3yb_

PDB Entry: 1d3y (more details), 2 Å

PDB Description: structure of the dna topoisomerase vi a subunit

SCOP Domain Sequences for d1d3yb_:

Sequence, based on SEQRES records: (download)

>d1d3yb_ e.12.1.1 (B:) DNA topoisomerase IV, alpha subunit {Archaeon Methanococcus jannaschii}
nqakifaqttkmlefakqlletddfstlreayyvsknwgearfddqqasnnviedleaal
gvlrehlgfipeedgssvvgplkiieetpegelvvdctklgtgaynipndvtklnletda
dfilaietsgmfarlnaerfwdkhncilvslkgvparatrrfikrlheehdlpvlvftdg
dpygylniyrtlkvgsgkaihladklsipaarligvtpqdiidydlpthplkeqdikrik
dglknddfvrsfpewqkalkqmldmgvraeqqslakyglkyvvntylpekikdestwlp

Sequence, based on observed residues (ATOM records): (download)

>d1d3yb_ e.12.1.1 (B:) DNA topoisomerase IV, alpha subunit {Archaeon Methanococcus jannaschii}
nqakifaqttkmlefakqlletddfstlreayyvsknwgearfddqqasnnviedleaal
gvlrehlgfipeedgssvvgplkiieetpegelvvdctklgtgaynipndvtklnletda
dfilaietsgmfarlnaerfwdkhncilvslkgvparatrrfikrlheehdlpvlvftdg
dpygylniyrtlkvgklsipaarligvtpqdiidydlpthplkeqdikrikdglknddfv
rsfpewqkalkqmldmgvraeqqslakyglkyvvntylpekikdestwlp

SCOP Domain Coordinates for d1d3yb_:

Click to download the PDB-style file with coordinates for d1d3yb_.
(The format of our PDB-style files is described here.)

Timeline for d1d3yb_: