Lineage for d1d3yb_ (1d3y B:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.12: DNA topoisomerase IV, alpha subunit [56725] (1 superfamily)
    2 domains: (1) toprim alpha/beta; (2) "winged helix"-like
  4. Superfamily e.12.1: DNA topoisomerase IV, alpha subunit [56726] (1 family) (S)
  5. Family e.12.1.1: DNA topoisomerase IV, alpha subunit [56727] (1 protein)
    domain 2 contains the catalytic tyrosine residue
  6. Protein DNA topoisomerase IV, alpha subunit [56728] (1 species)
  7. Species Methanococcus jannaschii [TaxId:2190] [56729] (1 PDB entry)
  8. Domain d1d3yb_: 1d3y B: [43253]
    complexed with mg, na

Details for d1d3yb_

PDB Entry: 1d3y (more details), 2 Å

PDB Description: structure of the dna topoisomerase vi a subunit
PDB Compounds: (B:) DNA topoisomerase vi a subunit

SCOPe Domain Sequences for d1d3yb_:

Sequence, based on SEQRES records: (download)

>d1d3yb_ e.12.1.1 (B:) DNA topoisomerase IV, alpha subunit {Methanococcus jannaschii [TaxId: 2190]}
nqakifaqttkmlefakqlletddfstlreayyvsknwgearfddqqasnnviedleaal
gvlrehlgfipeedgssvvgplkiieetpegelvvdctklgtgaynipndvtklnletda
dfilaietsgmfarlnaerfwdkhncilvslkgvparatrrfikrlheehdlpvlvftdg
dpygylniyrtlkvgsgkaihladklsipaarligvtpqdiidydlpthplkeqdikrik
dglknddfvrsfpewqkalkqmldmgvraeqqslakyglkyvvntylpekikdestwlp

Sequence, based on observed residues (ATOM records): (download)

>d1d3yb_ e.12.1.1 (B:) DNA topoisomerase IV, alpha subunit {Methanococcus jannaschii [TaxId: 2190]}
nqakifaqttkmlefakqlletddfstlreayyvsknwgearfddqqasnnviedleaal
gvlrehlgfipeedgssvvgplkiieetpegelvvdctklgtgaynipndvtklnletda
dfilaietsgmfarlnaerfwdkhncilvslkgvparatrrfikrlheehdlpvlvftdg
dpygylniyrtlkvgklsipaarligvtpqdiidydlpthplkeqdikrikdglknddfv
rsfpewqkalkqmldmgvraeqqslakyglkyvvntylpekikdestwlp

SCOPe Domain Coordinates for d1d3yb_ are not available.

Timeline for d1d3yb_:

Domains from other chains:
(mouse over for more information)
d1d3ya_