Lineage for d1cy7a_ (1cy7 A:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38511Fold e.10: Prokaryotic type I DNA topoisomerase [56711] (1 superfamily)
  4. 38512Superfamily e.10.1: Prokaryotic type I DNA topoisomerase [56712] (1 family) (S)
  5. 38513Family e.10.1.1: Prokaryotic type I DNA topoisomerase [56713] (2 proteins)
  6. 38514Protein DNA topoisomerase I, 67K N-terminal domain [56714] (1 species)
  7. 38515Species Escherichia coli [TaxId:562] [56715] (10 PDB entries)
  8. 38523Domain d1cy7a_: 1cy7 A: [43244]

Details for d1cy7a_

PDB Entry: 1cy7 (more details), 2.4 Å

PDB Description: complex of e.coli dna topoisomerase i with 5'-thymidine monophosphate

SCOP Domain Sequences for d1cy7a_:

Sequence, based on SEQRES records: (download)

>d1cy7a_ e.10.1.1 (A:) DNA topoisomerase I, 67K N-terminal domain {Escherichia coli}
gkalvivespakaktinkylgsdyvvkssvghirdlptsgsaakksadststktakkpkk
dergalvnrmgvdpwhnweahyevlpgkekvvselkqlaekadhiylatdldregeaiaw
hlreviggddarysrvvfneitknairqafnkpgelnidrvnaqqarrfmdrvvgymvsp
llwkkiarglsagrvqsvavrlvverereikafvpeefwevdastttpsgealalqvthq
ndkpfrpvnkeqtqaavsllekarysvleredkpttskpgapfitstlqqaastrlgfgv
kktmmmaqrlyeagyitymrtdstnlsqdavnmvrgyisdnfgkkylpespnqyaskens
qeaheairpsdvnvmaeslkdmeadaqklyqliwrqfvacqmtpakydsttltvgagdfr
lkargrilrfdgwtkvmpalrkgdedrilpavnkgdaltlveltpaqhftkpparfseas
lvkelekrgigrpstyasiistiqdrgyvrvenrrfyaekmgeivtdrleenfrelmnyd
ftaqmensldqvanheaewkavldhffsdftqqldkaekdpeeggmrpnqmvlts

Sequence, based on observed residues (ATOM records): (download)

>d1cy7a_ e.10.1.1 (A:) DNA topoisomerase I, 67K N-terminal domain {Escherichia coli}
gkalvivespakaktinkylgsdyvvkssvghirdlptdergalvnrmgvdpwhnweahy
evlpgkekvvselkqlaekadhiylatdldregeaiawhlreviggddarysrvvfneit
knairqafnkpgelnidrvnaqqarrfmdrvvgymvspllwkkiarglsagrvqsvavrl
vverereikafvpeefwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllek
arysvleredkpttskpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtd
stnlsqdavnmvrgyisdnfgkkylpespnqyensqeaheairpsdvnvmaeslkdmead
aqklyqliwrqfvacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpalilpav
nkgdaltlveltpaqhftkpparfseaslvkelekrgigrpstyasiistiqdrgyvrve
nrrfyaekmgeivtdrleenfrelmnydftaqmensldqvanheaewkavldhffsdftq
qldkaekdpeeggmrpnqmvlts

SCOP Domain Coordinates for d1cy7a_:

Click to download the PDB-style file with coordinates for d1cy7a_.
(The format of our PDB-style files is described here.)

Timeline for d1cy7a_: