Lineage for d1cyya_ (1cyy A:)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424842Fold e.10: Prokaryotic type I DNA topoisomerase [56711] (1 superfamily)
    4 domains: (1) Toprim alpha/beta; (2&4) "winged helix"-like; (3) barrel: n=6, S=8
  4. 424843Superfamily e.10.1: Prokaryotic type I DNA topoisomerase [56712] (1 family) (S)
    duplication: the protein chain passing through the domains 2-4 makes two structural repeats
    The active site is formed by the toprim and "winged helix" domains (domains 1 and 4); these two domains are also found in the type II topoisomerase (DNA gyrase A) and in the alpha subunit of topoisomerase IV
  5. 424844Family e.10.1.1: Prokaryotic type I DNA topoisomerase [56713] (3 proteins)
    domain 4 contains the catalytic tyrosine residue
  6. 424845Protein DNA topoisomerase I, 67K N-terminal domain [56714] (1 species)
  7. 424846Species Escherichia coli [TaxId:562] [56715] (12 PDB entries)
  8. 424852Domain d1cyya_: 1cyy A: [43239]

Details for d1cyya_

PDB Entry: 1cyy (more details), 2.15 Å

PDB Description: crystal structure of the 30 kda fragment of e. coli dna topoisomerase i. hexagonal form

SCOP Domain Sequences for d1cyya_:

Sequence, based on SEQRES records: (download)

>d1cyya_ e.10.1.1 (A:) DNA topoisomerase I, 67K N-terminal domain {Escherichia coli}
efwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllekarysvleredkptt
skpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtdstnlsqdavnmvrg
yisdnfgkkylpespnqyaskensqeaheairpsdvnvmaeslkdmeadaqklyqliwrq
fvacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpalrkgdedrilpavnkgd
altlveltpaqhftk

Sequence, based on observed residues (ATOM records): (download)

>d1cyya_ e.10.1.1 (A:) DNA topoisomerase I, 67K N-terminal domain {Escherichia coli}
efwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllekarysvleredkptt
skpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtdstnlsqdavnmvrg
yisdnfgkkylpespnqyaskensqeaheairpsdvnvmaeslkdmeadaqklyqliwrq
fvacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpaldrilpavnkgdaltlv
eltpaqhftk

SCOP Domain Coordinates for d1cyya_:

Click to download the PDB-style file with coordinates for d1cyya_.
(The format of our PDB-style files is described here.)

Timeline for d1cyya_: