SCOPe 2.08: Domain d1cyya_: 1cyy A:

Lineage for d1cyya_ (1cyy A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.10: Prokaryotic type I DNA topoisomerase [56711] (1 superfamily)
   4 domains: (1) Toprim alpha/beta; (2&4) "winged helix"-like; (3) barrel: n=6, S=8

4. Superfamily e.10.1: Prokaryotic type I DNA topoisomerase [56712] (2 families)
   duplication: the protein chain passing through the domains 2-4 makes two structural repeats
   The active site is formed by the toprim and "winged helix" domains (domains 1 and 4); these two domains are also found in the type II topoisomerase (DNA gyrase A) and in the alpha subunit of topoisomerase IV

5. Family e.10.1.1: Prokaryotic type I DNA topoisomerase [56713] (4 proteins)
   domain 4 contains the catalytic tyrosine residue

6. Protein DNA topoisomerase I, 67K N-terminal domain [56714] (1 species)

7. Species Escherichia coli [TaxId:562] [56715] (12 PDB entries)

8. Domain d1cyya_: 1cyy A: [43239]
   2nd and 3rd domains
   complexed with zn
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1cyya_

PDB Entry: 1cyy, 2.15 Å

PDB Description: crystal structure of the 30 kda fragment of e. coli dna topoisomerase i. hexagonal form

PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1cyya_:

Sequence, based on SEQRES records:

>d1cyya_ e.10.1.1 (A:) DNA topoisomerase I, 67K N-terminal domain {Escherichia coli [TaxId: 562]}
efwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllekarysvleredkptt
skpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtdstnlsqdavnmvrg
yisdnfgkkylpespnqyaskensqeaheairpsdvnvmaeslkdmeadaqklyqliwrq
fvacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpalrkgdedrilpavnkgd
altlveltpaqhftk

Sequence, based on observed residues (ATOM records):

>d1cyya_ e.10.1.1 (A:) DNA topoisomerase I, 67K N-terminal domain {Escherichia coli [TaxId: 562]}
efwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllekarysvleredkptt
skpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtdstnlsqdavnmvrg
yisdnfgkkylpespnqyaskensqeaheairpsdvnvmaeslkdmeadaqklyqliwrq
fvacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpaldrilpavnkgdaltlv
eltpaqhftk

Timeline for d1cyya_:

• d1cyya_ first appeared (with stable ids) in SCOP 1.55
  
• d1cyya_ appears in SCOPe 2.07