Lineage for d1ecla_ (1ecl A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.10: Prokaryotic type I DNA topoisomerase [56711] (1 superfamily)
    4 domains: (1) Toprim alpha/beta; (2&4) "winged helix"-like; (3) barrel: n=6, S=8
  4. Superfamily e.10.1: Prokaryotic type I DNA topoisomerase [56712] (2 families) (S)
    duplication: the protein chain passing through the domains 2-4 makes two structural repeats
    The active site is formed by the toprim and "winged helix" domains (domains 1 and 4); these two domains are also found in the type II topoisomerase (DNA gyrase A) and in the alpha subunit of topoisomerase IV
  5. Family e.10.1.1: Prokaryotic type I DNA topoisomerase [56713] (4 proteins)
    domain 4 contains the catalytic tyrosine residue
  6. Protein DNA topoisomerase I, 67K N-terminal domain [56714] (1 species)
  7. Species Escherichia coli [TaxId:562] [56715] (12 PDB entries)
  8. Domain d1ecla_: 1ecl A: [43238]

Details for d1ecla_

PDB Entry: 1ecl (more details), 1.9 Å

PDB Description: amino terminal 67kda domain of escherichia coli dna topoisomerase i (residues 2-590 of mature protein) cloning artifact adds two residues to the amino-terminus which were not observed in the experimental electron density (gly-2, ser-1).
PDB Compounds: (A:) escherichia coli topoisomerase I

SCOPe Domain Sequences for d1ecla_:

Sequence, based on SEQRES records: (download)

>d1ecla_ e.10.1.1 (A:) DNA topoisomerase I, 67K N-terminal domain {Escherichia coli [TaxId: 562]}
gkalvivespakaktinkylgsdyvvkssvghirdlptsgsaakksadststktakkpkk
dergalvnrmgvdpwhnweahyevlpgkekvvselkqlaekadhiylatdldregeaiaw
hlreviggddarysrvvfneitknairqafnkpgelnidrvnaqqarrfmdrvvgymvsp
llwkkiarglsagrvqsvavrlvverereikafvpeefwevdastttpsgealalqvthq
ndkpfrpvnkeqtqaavsllekarysvleredkpttskpgapfitstlqqaastrlgfgv
kktmmmaqrlyeagyitymrtdstnlsqdavnmvrgyisdnfgkkylpespnqyaskgns
qeaheairpsdvnvmaeslkdmeadaqklyqliwrqfvacqmtpakydsttltvgagdfr
lkargrilrfdgwtkvmpalrkgdedrilpavnkgdaltlveltpaqhftkpparfseas
lvkelekrgigrpstyasiistiqdrgyvrvenrrfyaekmgeivtdrleenfrelmnyd
ftaqmensldqvanheaewkavldhffsdftqqldkaekdpeeggmrpn

Sequence, based on observed residues (ATOM records): (download)

>d1ecla_ e.10.1.1 (A:) DNA topoisomerase I, 67K N-terminal domain {Escherichia coli [TaxId: 562]}
gkalvivespakaktinkylgsdyvvkssvghirdlpdergalvnrmgvdpwhnweahye
vlpgkekvvselkqlaekadhiylatdldregeaiawhlreviggddarysrvvfneitk
nairqafnkpgelnidrvnaqqarrfmdrvvgymvspllwkkiarglsagrvqsvavrlv
verereikafvpeefwevdastttpsgealalqvthqndkpfrpvnkeqtqaavslleka
rysvleredkpttskpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtds
tnlsqdavnmvrgyisdnfgkkylpespnqyaheairpsdvnvmaeslkdmeadaqklyq
liwrqfvacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpalrilpavnkgda
ltlveltpaqhftkpparfseaslvkelekrgigrpstyasiistiqdrgyvrvenrrfy
aekmgeivtdrleenfrelmnydftaqmensldqvanheaewkavldhffsdftqqldka
ekdpeeggmrpn

SCOPe Domain Coordinates for d1ecla_ are not available.

Timeline for d1ecla_: