SCOP 1.65: Domain d1cy9b_: 1cy9 B:

Lineage for d1cy9b_ (1cy9 B:)

1. Root: SCOP 1.65

2. Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)

3. Fold e.10: Prokaryotic type I DNA topoisomerase [56711] (1 superfamily)
   4 domains: (1) Toprim alpha/beta; (2&4) "winged helix"-like; (3) barrel: n=6, S=8

4. Superfamily e.10.1: Prokaryotic type I DNA topoisomerase [56712] (1 family)
   duplication: the protein chain passing through the domains 2-4 makes two structural repeats
   The active site is formed by the toprim and "winged helix" domains (domains 1 and 4); these two domains are also found in the type II topoisomerase (DNA gyrase A) and in the alpha subunit of topoisomerase IV

5. Family e.10.1.1: Prokaryotic type I DNA topoisomerase [56713] (3 proteins)
   domain 4 contains the catalytic tyrosine residue

6. Protein DNA topoisomerase I, 67K N-terminal domain [56714] (1 species)

7. Species Escherichia coli [TaxId:562] [56715] (10 PDB entries)

8. Domain d1cy9b_: 1cy9 B: [43237]
   2nd and 3rd domains

Details for d1cy9b_

PDB Entry: 1cy9, 1.8 Å

PDB Description: crystal structure of the 30 kda fragment of e. coli dna topoisomerase i. monoclinic form

SCOP Domain Sequences for d1cy9b_:

Sequence, based on SEQRES records:

>d1cy9b_ e.10.1.1 (B:) DNA topoisomerase I, 67K N-terminal domain {Escherichia coli}
peefwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllekarysvleredkp
ttskpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtdstnlsqdavnmv
rgyisdnfgkkylpespnqyaskensqeaheairpsdvnvmaeslkdmeadaqklyqliw
rqfvacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpalrkgdedrilpavnk
gdaltlveltpaqhftk

Sequence, based on observed residues (ATOM records):

>d1cy9b_ e.10.1.1 (B:) DNA topoisomerase I, 67K N-terminal domain {Escherichia coli}
peefwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllekarysvleredkp
ttskpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtdstnlsqdavnmv
rgyisdnfgkkylpespnqyasheairpsdvnvmaeslkdmeadaqklyqliwrqfvacq
mtpakydsttltvgagdfrlkargrilrfdgwtkvmpdrilpavnkgdaltlveltpaqh
ftk

Timeline for d1cy9b_:

• d1cy9b_ first appeared (with stable ids) in SCOP 1.55
  
• d1cy9b_ appears in SCOP 1.63
  
• d1cy9b_ appears in SCOP 1.67
  
• d1cy9b_ appears in the current release, SCOPe 2.08