Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds) |
Fold e.10: Prokaryotic type I DNA topoisomerase [56711] (1 superfamily) 4 domains: (1) Toprim alpha/beta; (2&4) "winged helix"-like; (3) barrel: n=6, S=8 |
Superfamily e.10.1: Prokaryotic type I DNA topoisomerase [56712] (1 family) duplication: the protein chain passing through the domains 2-4 makes two structural repeats The active site is formed by the toprim and "winged helix" domains (domains 1 and 4); these two domains are also found in the type II topoisomerase (DNA gyrase A) and in the alpha subunit of topoisomerase IV |
Family e.10.1.1: Prokaryotic type I DNA topoisomerase [56713] (3 proteins) domain 4 contains the catalytic tyrosine residue |
Protein DNA topoisomerase I, 67K N-terminal domain [56714] (1 species) |
Species Escherichia coli [TaxId:562] [56715] (12 PDB entries) |
Domain d1cy9a_: 1cy9 A: [43236] |
PDB Entry: 1cy9 (more details), 1.8 Å
SCOP Domain Sequences for d1cy9a_:
Sequence, based on SEQRES records: (download)
>d1cy9a_ e.10.1.1 (A:) DNA topoisomerase I, 67K N-terminal domain {Escherichia coli} fvpeefwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllekarysvlered kpttskpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtdstnlsqdavn mvrgyisdnfgkkylpespnqyaskensqeaheairpsdvnvmaeslkdmeadaqklyql iwrqfvacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpalrkgdedrilpav nkgdaltlveltpaqhftkp
>d1cy9a_ e.10.1.1 (A:) DNA topoisomerase I, 67K N-terminal domain {Escherichia coli} fvpeefwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllekarysvlered kpttskpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtdstnlsqdavn mvrgyisdnfgkkylpespnqyasheairpsdvnvmaeslkdmeadaqklyqliwrqfva cqmtpakydsttltvgagdfrlkargrilrfdgwtkvmdrilpavnkgdaltlveltpaq hftkp
Timeline for d1cy9a_: