Lineage for d1cy9a_ (1cy9 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018324Fold e.10: Prokaryotic type I DNA topoisomerase [56711] (1 superfamily)
    4 domains: (1) Toprim alpha/beta; (2&4) "winged helix"-like; (3) barrel: n=6, S=8
  4. 3018325Superfamily e.10.1: Prokaryotic type I DNA topoisomerase [56712] (2 families) (S)
    duplication: the protein chain passing through the domains 2-4 makes two structural repeats
    The active site is formed by the toprim and "winged helix" domains (domains 1 and 4); these two domains are also found in the type II topoisomerase (DNA gyrase A) and in the alpha subunit of topoisomerase IV
  5. 3018326Family e.10.1.1: Prokaryotic type I DNA topoisomerase [56713] (4 proteins)
    domain 4 contains the catalytic tyrosine residue
  6. 3018327Protein DNA topoisomerase I, 67K N-terminal domain [56714] (1 species)
  7. 3018328Species Escherichia coli [TaxId:562] [56715] (12 PDB entries)
  8. 3018330Domain d1cy9a_: 1cy9 A: [43236]
    2nd and 3rd domains
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1cy9a_

PDB Entry: 1cy9 (more details), 1.8 Å

PDB Description: crystal structure of the 30 kda fragment of e. coli dna topoisomerase i. monoclinic form
PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1cy9a_:

Sequence, based on SEQRES records: (download)

>d1cy9a_ e.10.1.1 (A:) DNA topoisomerase I, 67K N-terminal domain {Escherichia coli [TaxId: 562]}
fvpeefwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllekarysvlered
kpttskpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtdstnlsqdavn
mvrgyisdnfgkkylpespnqyaskensqeaheairpsdvnvmaeslkdmeadaqklyql
iwrqfvacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpalrkgdedrilpav
nkgdaltlveltpaqhftkp

Sequence, based on observed residues (ATOM records): (download)

>d1cy9a_ e.10.1.1 (A:) DNA topoisomerase I, 67K N-terminal domain {Escherichia coli [TaxId: 562]}
fvpeefwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllekarysvlered
kpttskpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtdstnlsqdavn
mvrgyisdnfgkkylpespnqyasheairpsdvnvmaeslkdmeadaqklyqliwrqfva
cqmtpakydsttltvgagdfrlkargrilrfdgwtkvmdrilpavnkgdaltlveltpaq
hftkp

SCOPe Domain Coordinates for d1cy9a_:

Click to download the PDB-style file with coordinates for d1cy9a_.
(The format of our PDB-style files is described here.)

Timeline for d1cy9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cy9b_