Lineage for d9icaa2 (9ica A:92-335)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 87030Fold e.9: Nucleotidyltransferases [56698] (1 superfamily)
  4. 87031Superfamily e.9.1: Nucleotidyltransferases [56699] (3 families) (S)
  5. 87032Family e.9.1.1: DNA polymerase beta, catalytic (31 kD) fragment [56700] (1 protein)
  6. 87033Protein DNA polymerase beta, catalytic (31 kD) fragment [56701] (2 species)
  7. 87034Species Human (Homo sapiens) [TaxId:9606] [56702] (90 PDB entries)
  8. 87082Domain d9icaa2: 9ica A:92-335 [43168]
    Other proteins in same PDB: d9icaa1

Details for d9icaa2

PDB Entry: 9ica (more details), 3 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex + 2'-deoxyadenosine-5'-o-(1-thiotriphosphate), soaked in the presence of datp(alpha)s and mncl2

SCOP Domain Sequences for d9icaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icaa2 e.9.1.1 (A:92-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens)}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfekrip
reemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqpkll
hqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycgvly
ftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyrepk
drse

SCOP Domain Coordinates for d9icaa2:

Click to download the PDB-style file with coordinates for d9icaa2.
(The format of our PDB-style files is described here.)

Timeline for d9icaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d9icaa1