Lineage for d1bpya2 (1bpy A:92-335)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38384Fold e.9: Nucleotidyltransferases [56698] (1 superfamily)
  4. 38385Superfamily e.9.1: Nucleotidyltransferases [56699] (3 families) (S)
  5. 38386Family e.9.1.1: DNA polymerase beta, catalytic (31 kD) fragment [56700] (1 protein)
  6. 38387Protein DNA polymerase beta, catalytic (31 kD) fragment [56701] (2 species)
  7. 38388Species Human (Homo sapiens) [TaxId:9606] [56702] (90 PDB entries)
  8. 38389Domain d1bpya2: 1bpy A:92-335 [43122]
    Other proteins in same PDB: d1bpya1

Details for d1bpya2

PDB Entry: 1bpy (more details), 2.2 Å

PDB Description: human dna polymerase beta complexed with gapped dna and ddctp

SCOP Domain Sequences for d1bpya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpya2 e.9.1.1 (A:92-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens)}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfekrip
reemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqpkll
hqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycgvly
ftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyrepk
drse

SCOP Domain Coordinates for d1bpya2:

Click to download the PDB-style file with coordinates for d1bpya2.
(The format of our PDB-style files is described here.)

Timeline for d1bpya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bpya1