Lineage for d1c2pa1 (1c2p A:3-563)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246832Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2246833Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2247714Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 2247722Protein Viral RNA polymerase [56695] (18 species)
  7. 2247813Species Hepatitis C virus [TaxId:11103] [56697] (72 PDB entries)
  8. 2247853Domain d1c2pa1: 1c2p A:3-563 [43117]
    Other proteins in same PDB: d1c2pa2, d1c2pb2

Details for d1c2pa1

PDB Entry: 1c2p (more details), 1.9 Å

PDB Description: hepatitis c virus ns5b rna-dependent rna polymerase
PDB Compounds: (A:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d1c2pa1:

Sequence, based on SEQRES records: (download)

>d1c2pa1 e.8.1.4 (A:3-563) Viral RNA polymerase {Hepatitis C virus [TaxId: 11103]}
sytwtgalitpcaaeesklpinalsnsllrhhnmvyattsrsaglrqkkvtfdrlqvldd
hyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrnlsskavnhihsv
wkdlledtvtpidttimaknevfcvqpekggrkparlivfpdlgvrvcekmalydvvstl
pqvvmgssygfqyspgqrveflvntwkskknpmgfsydtrcfdstvtendirveesiyqc
cdlapearqaikslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkasaa
craaklqdctmlvngddlvvicesagvqedaaslrafteamtrysappgdppqpeydlel
itscssnvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlwar
milmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafslhsyspgei
nrvasclrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavktklkltpipaa
sqldlsgwfvagysggdiyhs

Sequence, based on observed residues (ATOM records): (download)

>d1c2pa1 e.8.1.4 (A:3-563) Viral RNA polymerase {Hepatitis C virus [TaxId: 11103]}
sytwtgalitpcaaeesklpinalsnsllrhhnmvyattsrsaglrqkkvtfdrlqvldd
hyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrnlsskavnhihsv
wkdlledtvtpidttimaknevfcvqrkparlivfpdlgvrvcekmalydvvstlpqvvm
gssygfqyspgqrveflvntwkskknpmgfsydtrcfdstvtendirveesiyqccdlap
earqaikslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkasaacraak
lqdctmlvngddlvvicesagvqedaaslrafteamtrysappgdppqpeydlelitscs
snvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlwarmilmt
hffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafslhsyspgeinrvas
clrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavktklkltpipaasqldl
sgwfvagysggdiyhs

SCOPe Domain Coordinates for d1c2pa1:

Click to download the PDB-style file with coordinates for d1c2pa1.
(The format of our PDB-style files is described here.)

Timeline for d1c2pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c2pa2