Lineage for d1ceza_ (1cez A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2572007Family e.8.1.3: T7 RNA polymerase [56691] (2 proteins)
  6. 2572008Protein T7 RNA polymerase [56692] (1 species)
    multidomain; mostly alpha
  7. 2572009Species Bacteriophage T7 [TaxId:10760] [56693] (11 PDB entries)
  8. 2572011Domain d1ceza_: 1cez A: [43110]
    promoter complex
    protein/DNA complex; protein/RNA complex

Details for d1ceza_

PDB Entry: 1cez (more details), 2.4 Å

PDB Description: crystal structure of a t7 rna polymerase-t7 promoter complex
PDB Compounds: (A:) protein (bacteriophage T7 RNA polymerase)

SCOPe Domain Sequences for d1ceza_:

Sequence, based on SEQRES records: (download)

>d1ceza_ e.8.1.3 (A:) T7 RNA polymerase {Bacteriophage T7 [TaxId: 10760]}
iakndfsdielaaipfntladhygerlareqlalehesyemgearfrkmferqlkageva
dnaaakplittllpkmiarindwfeevkakrgkrptafqflqeikpeavayitikttlac
ltsadnttvqavasaigraiedearfgrirdleakhfkknveeqlnkrvghvykkafmqv
veadmlskgllggeawsswhkedsihvgvrciemliestgmvslhrqnagvvgqdsetie
lapeyaeaiatragalagispmfqpcvvppkpwtgitgggywangrrplalvrthskkal
mryedvympevykainiaqntawkinkkvlavanvitkwkhcpvedipaiereelpmkpe
didmnpealtawkraaaavyrkdkarksrrislefmleqankfanhkaiwfpynmdwrgr
vyavsmfnpqgndmtkglltlakgkpigkegyywlkihgancagvdkvpfperikfieen
henimacaksplentwwaeqdspfcflafcfeyagvqhhglsyncslplafdgscsgiqh
fsamlrdevggravnllpsetvqdiygivakkvneilqadaingtdnevvtvtdentgei
sekvklgtkalagqwlaygvtrsvtkrsvmtlaygskefgfrqqvledtiqpaidsgkgl
mftqpnqaagymakliwesvsvtvvaaveamnwlksaakllaaevkdkktgeilrkrcav
hwvtpdgfpvwqeykkpiqtrlnlmflgqfrlqptintnkdseidahkqesgiapnfvhs
qdgshlrktvvwahekygiesfalihdsfgtipadaanlfkavretmvdtyescdvladf
ydqfadqlhesqldkmpalpakgnlnlrdilesdfafa

Sequence, based on observed residues (ATOM records): (download)

>d1ceza_ e.8.1.3 (A:) T7 RNA polymerase {Bacteriophage T7 [TaxId: 10760]}
iakndfsdielaaipfntladhygerlareqlalehesyemgearfrkmfplittllpkm
iarindwfeevkakrgkrptafqflqeikpeavayitikttlacltsadnttvqavasai
graiedearfgrirdleakhfkknveeqlnkrvghvykkafmqvveadmlskgllggeaw
sswhkedsihvgvrciemliestgmvslhrqnagvvgqdsetielapeyaeaiatragal
agispmfqpcvvppkpwtgitgggywangrrplalvrthskkalmryedvympevykain
iaqntawkinkkvlavanvitkwkhcpvedipaiereelpmkpedidmnpealtawkraa
aavyrkdkarksrrislefmleqankfanhkaiwfpynmdwrgrvyavsmfnpqgndmtk
glltlakgkpigkegyywlkihgancagvdkvpfperikfieenhenimacaksplentw
waeqdspfcflafcfeyagvqhhglsyncslplafdgscsgiqhfsamlrdevggravnl
lpsetvqdiygivakkvneilqadaingtdnevvtvtdentgeisekvklgtkalagqwl
aygvtrsvtkrsvmtlaygskefgfrqqvledtiqpaidsgkglmftqpnqaagymakli
wesvsvtvvaaveamnwlksaakllaaevkdkktgeilrkrcavhwvtpdgfpvwqeykk
piqtrlnlmflgqfrlqptintnkdseidahkqesgiapnfvhsqdgshlrktvvwahek
ygiesfalihdsfgtipadaanlfkavretmvdtyescdvladfydqfadqlhesqldkm
palpakgnlnlrdilesdfafa

SCOPe Domain Coordinates for d1ceza_:

Click to download the PDB-style file with coordinates for d1ceza_.
(The format of our PDB-style files is described here.)

Timeline for d1ceza_: