SCOP 1.67: Domain d2hmib_: 2hmi B:

Lineage for d2hmib_ (2hmi B:)

1. Root: SCOP 1.67

2. Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (71 PDB entries)

8. Domain d2hmib_: 2hmi B: [43107]
   Other proteins in same PDB: d2hmia1, d2hmic1, d2hmic2, d2hmid1, d2hmid2
   protein/protein/DNA complex; mutant
   less ordered regions are modeled as poly-ALA

Details for d2hmib_

PDB Entry: 2hmi, 2.8 Å

PDB Description: hiv-1 reverse transcriptase/fragment of fab 28/dna complex

SCOP Domain Sequences for d2hmib_:

Sequence; same for both SEQRES and ATOM records:

>d2hmib_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyqle

Timeline for d2hmib_:

• d2hmib_ first appeared (with stable ids) in SCOP 1.55, called d2hmib1
  
• d2hmib_ appears in SCOP 1.65
  
• d2hmib_ appears in SCOP 1.69
  
• d2hmib_ appears in the current release, SCOPe 2.08