Lineage for d2hmia2 (2hmi A:1-429)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2571504Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 2571505Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. 2571549Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (186 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2571807Domain d2hmia2: 2hmi A:1-429 [43106]
    Other proteins in same PDB: d2hmia1, d2hmic1, d2hmic2, d2hmid1, d2hmid2
    less ordered regions are modeled as poly-ALA
    protein/DNA complex

Details for d2hmia2

PDB Entry: 2hmi (more details), 2.8 Å

PDB Description: hiv-1 reverse transcriptase/fragment of fab 28/dna complex
PDB Compounds: (A:) subunit of v-1 reverse transcriptase

SCOPe Domain Sequences for d2hmia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmia2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d2hmia2:

Click to download the PDB-style file with coordinates for d2hmia2.
(The format of our PDB-style files is described here.)

Timeline for d2hmia2: