SCOPe 2.05: Domain d3hvta2: 3hvt A:2-429

Lineage for d3hvta2 (3hvt A:2-429)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (153 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d3hvta2: 3hvt A:2-429 [43066]
   Other proteins in same PDB: d3hvta1
   complexed with nvp

Details for d3hvta2

PDB Entry: 3hvt, 2.9 Å

PDB Description: structural basis of asymmetry in the human immunodeficiency virus type 1 reverse transcriptase heterodimer

PDB Compounds: (A:) hiv-1 reverse transcriptase (subunit p66)

SCOPe Domain Sequences for d3hvta2:

Sequence; same for both SEQRES and ATOM records:

>d3hvta2 e.8.1.2 (A:2-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
ispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvf
aikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpld
edfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviy
qymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtv
qpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeael
elaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgah
tndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpp
lvklwyql

Timeline for d3hvta2:

• d3hvta2 first appeared (with stable ids) in SCOP 1.55
  
• d3hvta2 appears in SCOPe 2.04
  
• d3hvta2 appears in SCOPe 2.06
  
• d3hvta2 appears in the current release, SCOPe 2.08