Lineage for d1uwbb_ (1uwb B:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (203 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. Domain d1uwbb_: 1uwb B: [43063]
    Other proteins in same PDB: d1uwba1
    complexed with tbo

Details for d1uwbb_

PDB Entry: 1uwb (more details), 3.2 Å

PDB Description: tyr 181 cys hiv-1 rt/8-cl tibo
PDB Compounds: (B:) reverse transcriptase

SCOPe Domain Sequences for d1uwbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwbb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
cqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwy

SCOPe Domain Coordinates for d1uwbb_ are not available.

Timeline for d1uwbb_:

Domains from other chains:
(mouse over for more information)
d1uwba1, d1uwba2