SCOPe 2.01: Domain d1hnvb_: 1hnv B:

Lineage for d1hnvb_ (1hnv B:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (126 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d1hnvb_: 1hnv B: [43057]
   Other proteins in same PDB: d1hnva1
   complexed with tbo

Details for d1hnvb_

PDB Entry: 1hnv, 3 Å

PDB Description: structure of hiv-1 rt(slash)tibo r 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors

PDB Compounds: (B:) hiv-1 reverse transcriptase (subunit p51)

SCOPe Domain Sequences for d1hnvb_:

Sequence; same for both SEQRES and ATOM records:

>d1hnvb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwy

Timeline for d1hnvb_:

• d1hnvb_ first appeared (with stable ids) in SCOP 1.55, called d1hnvb1
  
• d1hnvb_ appears in SCOP 1.75
  
• d1hnvb_ appears in SCOPe 2.02
  
• d1hnvb_ appears in the current release, SCOPe 2.08