Lineage for d1rt3b_ (1rt3 B:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339256Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 339257Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 339321Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 339322Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 339323Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (63 PDB entries)
  8. 339414Domain d1rt3b_: 1rt3 B: [43053]
    Other proteins in same PDB: d1rt3a1
    complexed with u05; mutant

Details for d1rt3b_

PDB Entry: 1rt3 (more details), 3 Å

PDB Description: azt drug resistant hiv-1 reverse transcriptase complexed with 1051u91
PDB Compounds: (B:)

SCOP Domain Sequences for d1rt3b_:

Sequence, based on SEQRES records: (download)

>d1rt3b_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
kknstrwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqym
ddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpi
vlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelela
enreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtnd
vkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvk
lwyq

Sequence, based on observed residues (ATOM records): (download)

>d1rt3b_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
kknstrwrklvdfrelnkrtqdfiphpaglkkkksvtvldvgdayfsvpldedfrkytaf
tipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvg
sdleigqhrtkieelrqhllrwglgyelhpdkwtvqpivlpekdswtvndiqklvgklnw
asqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdli
aeiqkqgqgqwtyqiyqepfknlktgkyarmtndvkqlteavqkittesiviwgktpkfk
lpiqketwetwwteywqatwipewefvntpplvklwyq

SCOP Domain Coordinates for d1rt3b_:

Click to download the PDB-style file with coordinates for d1rt3b_.
(The format of our PDB-style files is described here.)

Timeline for d1rt3b_: