Lineage for d1rt2b_ (1rt2 B:)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424451Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 424452Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 424541Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 424542Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 424543Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (71 PDB entries)
  8. 424558Domain d1rt2b_: 1rt2 B: [43033]
    Other proteins in same PDB: d1rt2a1
    complexed with tnk

Details for d1rt2b_

PDB Entry: 1rt2 (more details), 2.55 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase complexed with tnk- 651
PDB Compounds: (B:)

SCOP Domain Sequences for d1rt2b_:

Sequence, based on SEQRES records: (download)

>d1rt2b_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
etvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaikk
kdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfr
kytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymd
dlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpiv
lpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelae
nreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndv
kqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvkl
wyqleke

Sequence, based on observed residues (ATOM records): (download)

>d1rt2b_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
etvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaikk
kdstkwrklvdfrelnkrtqdfwephpaglkkkksvtvldvgdayfsvpldedfrkytaf
tipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvg
sdleigqhrtkieelrqhllryelhpdkwtvqpivlpekdswtvndiqklvgklnwasqi
ypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdliaeiq
kqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiviwgktpkfk
lpiqketwetwwteywqatwipewefvntpplvklwyqleke

SCOP Domain Coordinates for d1rt2b_:

Click to download the PDB-style file with coordinates for d1rt2b_.
(The format of our PDB-style files is described here.)

Timeline for d1rt2b_: