SCOP 1.73: Domain d1rtha2: 1rth A:1-429

Lineage for d1rtha2 (1rth A:1-429)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (90 PDB entries)

8. Domain d1rtha2: 1rth A:1-429 [43028]
   Other proteins in same PDB: d1rtha1

Details for d1rtha2

PDB Entry: 1rth, 2.2 Å

PDB Description: high resolution structures of hiv-1 rt from four rt-inhibitor complexes

PDB Compounds: (A:) hiv-1 reverse transcriptase

SCOP Domain Sequences for d1rtha2:

Sequence; same for both SEQRES and ATOM records:

>d1rtha2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d1rtha2:

• d1rtha2 first appeared (with stable ids) in SCOP 1.55
  
• d1rtha2 appears in SCOP 1.71
  
• d1rtha2 appears in SCOP 1.75
  
• d1rtha2 appears in the current release, SCOPe 2.08