Lineage for d1rtha2 (1rth A:1-429)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 618192Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 618193Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 618312Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 618313Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 618314Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (83 PDB entries)
  8. 618322Domain d1rtha2: 1rth A:1-429 [43028]
    Other proteins in same PDB: d1rtha1

Details for d1rtha2

PDB Entry: 1rth (more details), 2.2 Å

PDB Description: high resolution structures of hiv-1 rt from four rt-inhibitor complexes
PDB Compounds: (A:)

SCOP Domain Sequences for d1rtha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rtha2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOP Domain Coordinates for d1rtha2:

Click to download the PDB-style file with coordinates for d1rtha2.
(The format of our PDB-style files is described here.)

Timeline for d1rtha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rtha1
View in 3D
Domains from other chains:
(mouse over for more information)
d1rthb1